Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A10 Rabbit pAb (APR21214N)

Product Specifications

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality S100A10 Rabbit pAb (APR21214N) .

Synonyms

S100A10; 42C; ANX2L; ANX2LG; CAL1L; CLP11; Ca[1]; GP11; P11; p10

Gene ID

6281

UniProt

P60903

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 11KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6281

Uniprot URL

https://www.uniprot.org/uniprot/P60903

AA Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human B3GNT4 activation kit by CRISPRa
GA112435 1 Kit

Human B3GNT4 activation kit by CRISPRa

Sign In for Pricing
View Details
KCTD1 (NM_001136205) Human Over-expression Lysate
LY427853 100 µg

KCTD1 (NM_001136205) Human Over-expression Lysate

Sign In for Pricing
View Details
Trpv1 (105-115) Rabbit Polyclonal Antibody
AP26428AF-L 500 µg

Trpv1 (105-115) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2218-01 50 μL

KIFBP Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2218-02 100 µL

KIFBP Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2218-03 1 mL

KIFBP Antibody

Sign In for Pricing
View Details