Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFAB1 Rabbit pAb (APR21213N)

Product Specifications

Background

Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I, which functions in the transfer of electrons from NADH to the respiratory chain.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NDUFAB1 Rabbit pAb (APR21213N) .

Synonyms

NDUFAB1; ACP; ACP1; FASN2A; SDAP

Gene ID

4706

UniProt

O14561

Cellular Locus

Mitochondrion

Applications

WB (Rana sylvatica)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17Da Observed MW: 12KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4706

Uniprot URL

https://www.uniprot.org/uniprot/O14561

AA Sequence

PALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIAD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FA2H shRNA (UAS) - Lentiviral human FA2H shRNA (UAS, RFP) plasmid
GTR15330472 1 Vial

Lentiviral human FA2H shRNA (UAS) - Lentiviral human FA2H shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Pigeon Basonuclin 1 (BNC1) ELISA Kit
MBS9906614 Inquire

Pigeon Basonuclin 1 (BNC1) ELISA Kit

Sign In for Pricing
View Details
P2X3 (P2RX3) Rabbit Polyclonal Antibody
TA379548 100 µL

P2X3 (P2RX3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Eda2r 3'UTR GFP Stable Cell Line
TU155591 1.0 mL

Eda2r 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
KIR2DL3 (Killer Cell Immunoglobulin-like Receptor Two Domains Long Cytoplasmic Tail 3, Killer Cell Immunoglobulin Like Receptor 2DL3, CD158b, GL183, MHC Class I NK Cell Receptor, Natural Killer Associated Transcript 2, NKAT2a, NKAT2b, p58, p58 Natural Kil
MBS6383583-01 0.1 mL

KIR2DL3 (Killer Cell Immunoglobulin-like Receptor Two Domains Long Cytoplasmic Tail 3, Killer Cell Immunoglobulin Like Receptor 2DL3, CD158b, GL183, MHC Class I NK Cell Receptor, Natural Killer Associated Transcript 2, NKAT2a, NKAT2b, p58, p58 Natural Kil

Sign In for Pricing
View Details
KIR2DL3 (Killer Cell Immunoglobulin-like Receptor Two Domains Long Cytoplasmic Tail 3, Killer Cell Immunoglobulin Like Receptor 2DL3, CD158b, GL183, MHC Class I NK Cell Receptor, Natural Killer Associated Transcript 2, NKAT2a, NKAT2b, p58, p58 Natural Kil
MBS6383583-02 5x 0.1 mL

KIR2DL3 (Killer Cell Immunoglobulin-like Receptor Two Domains Long Cytoplasmic Tail 3, Killer Cell Immunoglobulin Like Receptor 2DL3, CD158b, GL183, MHC Class I NK Cell Receptor, Natural Killer Associated Transcript 2, NKAT2a, NKAT2b, p58, p58 Natural Kil

Sign In for Pricing
View Details