Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D3 Rabbit pAb (APR21197N)

Product Specifications

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality UBE2D3 Rabbit pAb (APR21197N) .

Synonyms

UBE2D3; E2 (17) KB3; UBC4/5; UBCH5C

Gene ID

7323

UniProt

P61077

Cellular Locus

Cell membrane, Endosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7323

Uniprot URL

https://www.uniprot.org/uniprot/P61077

AA Sequence

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTIS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Artn Lentiviral Activation Particles (h)
sc-405922-LAC 200 µL

Artn Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Anti-PTPLA Antibody
MBS8323020-01 0.03 mL

Anti-PTPLA Antibody

Sign In for Pricing
View Details
Anti-PTPLA Antibody
MBS8323020-02 0.05 mL

Anti-PTPLA Antibody

Sign In for Pricing
View Details
Anti-PTPLA Antibody
MBS8323020-03 0.1 mL

Anti-PTPLA Antibody

Sign In for Pricing
View Details
Anti-PTPLA Antibody
MBS8323020-04 0.2 mL

Anti-PTPLA Antibody

Sign In for Pricing
View Details
Anti-PTPLA Antibody
MBS8323020-05 5x 0.2 mL

Anti-PTPLA Antibody

Sign In for Pricing
View Details