Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTRR Rabbit pAb (APR21174N)

Product Specifications

Background

This gene encodes a member of the ferredoxin-NADP (+) reductase (FNR) family of electron transferases. This protein functions in the synthesis of methionine by regenerating methionine synthase to a functional state. Because methionine synthesis requires methyl-group transfer by a folate donor, activity of the encoded enzyme is important for folate metabolism and cellular methylation. Mutations in this gene can cause homocystinuria-megaloblastic anemia, cbl E type. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MTRR Rabbit pAb (APR21174N) .

Synonyms

MTRR; MSR; cblE

Gene ID

4552

UniProt

Q9UBK8

Cellular Locus

Cytoplasm, Cytoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 6kDa/77kDa/80kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4552

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBK8

AA Sequence

TAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGLLGLGDSEYTYFCNGGKIIDKRLQELGARHFYDTGHADDCVGLELVVEPWIAGLWPALRKHFRSSRGQEEISGALPVASPASSRTDLVKSELLHIESQVELLRFDDSGRKDSEVLKQNAVNSNQSNVVIEDFESSLTR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal FGF-21 Antibody (461804) [Janelia Fluor 646]
FAB25372J 0.1 mL

Mouse Monoclonal FGF-21 Antibody (461804) [Janelia Fluor 646]

Sign In for Pricing
View Details
Human Meprin A Alpha (MEP1a) ELISA Kit
QY-E02922 96 Tests

Human Meprin A Alpha (MEP1a) ELISA Kit

Sign In for Pricing
View Details
Human MCP/CD46 (Membrane Cofactor Protein) ELISA Kit
EH1452 96 Tests

Human MCP/CD46 (Membrane Cofactor Protein) ELISA Kit

Sign In for Pricing
View Details
Spic (NM_011461) Mouse Tagged Lenti ORF Clone
MR203000L1 10 µg

Spic (NM_011461) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IL-18 (IGIF, IL-1g, IL1F4, IL-18, Iboctadekin, , IL-1 gamma, , Interleukin-1 gamma, Interferon gamma-inducing factor, IFN-gamma-inducing factor) (HRP) discontinued
144631-HRP 100 µL

IL-18 (IGIF, IL-1g, IL1F4, IL-18, Iboctadekin, , IL-1 gamma, , Interleukin-1 gamma, Interferon gamma-inducing factor, IFN-gamma-inducing factor) (HRP) discontinued

Sign In for Pricing
View Details
Adenosylhomocysteinase (AHCY) Antibody
abx171083 1 mL

Adenosylhomocysteinase (AHCY) Antibody

Sign In for Pricing
View Details