Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCX Rabbit pAb (APR21170N)

Product Specifications

Background

This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, mental retardation, subcortical band heterotopia ('double cortex' syndrome) in females and lissencephaly ('smooth brain' syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DCX Rabbit pAb (APR21168N1) .

Synonyms

DBCN; DC; LISX; SCLH; XLIS; DCX

Gene ID

1641

UniProt

O43602

Cellular Locus

Cell projection, Cytoplasm

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 45KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1641

Uniprot URL

https://www.uniprot.org/uniprot/O43602

AA Sequence

HDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSLGDSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (KIP1/769), CF594 conjugate, 0.1mg/mL
BNC940769-100 1x 100 µL

P27 / KIP1 (KIP1/769), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nectin 2 (NECTIN2) (NM_002856) Human Over-expression Lysate
LY419084 100 µg

Nectin 2 (NECTIN2) (NM_002856) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC35B2 (NM_001286513) Human Tagged ORF Clone
RG237568 10 µg

SLC35B2 (NM_001286513) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human CCL23 Antibody Pair Set
E-KAB-0184 50 µL & 100 µg

Human CCL23 Antibody Pair Set

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS716822 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
HLA-DRB (MHC II) (DA2), Biotin conjugate, 0.1mg/mL
BNCB2281-500 1x 500 µL

HLA-DRB (MHC II) (DA2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details