Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RYBP Rabbit pAb (APR21163N)

Product Specifications

Background

Component of a Polycomb group (PcG multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Component of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females. May stimulate ubiquitination of histone H2A 'Lys-119' by recruiting the complex to target sites (By similarity. Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes. May also regulate the ubiquitin-mediated proteasomal degradation of other proteins like FANK1 to regulate apoptosis. May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1. May bind to DNA (By similarity. May play a role in the repression of tumor growth and metastasis in breast cancer by down-regulating SRRM3.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RYBP Rabbit pAb (APR21157N5) .

Synonyms

RYBP; AAP1; APAP-1; DEDAF; YEAF1

Gene ID

23429

UniProt

Q8N488

Cellular Locus

Cytoplasm, Nucleus, nucleoplasm

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23429

Uniprot URL

https://www.uniprot.org/uniprot/Q8N488

AA Sequence

PSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TC-PTP CRISPR/Cas9 KO Plasmid (m)
sc-422509 20 µg

TC-PTP CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Anti-JAK2 antibody
STJ93794 200 µl

Anti-JAK2 antibody

Sign In for Pricing
View Details
2- (4-Ethoxy-1H-indol-3-yl) acetic acid
RHA67569-01 50 mg

2- (4-Ethoxy-1H-indol-3-yl) acetic acid

Sign In for Pricing
View Details
2- (4-Ethoxy-1H-indol-3-yl) acetic acid
RHA67569-02 0.5 g

2- (4-Ethoxy-1H-indol-3-yl) acetic acid

Sign In for Pricing
View Details
METTL13 Polyclonal Antibody
E-AB-61532-01 60 µL

METTL13 Polyclonal Antibody

Sign In for Pricing
View Details
METTL13 Polyclonal Antibody
E-AB-61532-02 120 µL

METTL13 Polyclonal Antibody

Sign In for Pricing
View Details