Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Butyrylcholinesterase Rabbit pAb (APR21157N)

Product Specifications

Background

Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Butyrylcholinesterase Rabbit pAb (APR21157N) .

Synonyms

BCHE; CHE1; CHE2; E1

Gene ID

590

UniProt

P06276

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 68kDa Observed MW: 68kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=590

Uniprot URL

https://www.uniprot.org/uniprot/P06276

AA Sequence

EDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNASE4 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-6583R-APC-Cy5.5 100 µL

RNASE4 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
TranslationBlocker Human iNOS siRNA, 2nmol
QX45-2nmol 2nmol

TranslationBlocker Human iNOS siRNA, 2nmol

Sign In for Pricing
View Details
RAPGEF3 (CGEF1, EPAC, EPAC1, Rap Guanine Nucleotide Exchange Factor 3, Exchange Factor Directly Activated by cAMP 1, Exchange Protein Directly Activated by cAMP 1, Rap1 Guanine-nucleotide-exchange Factor Directly Activated by cAMP, cAMP-regulated Guanine
MBS6192179-01 0.1 mL

RAPGEF3 (CGEF1, EPAC, EPAC1, Rap Guanine Nucleotide Exchange Factor 3, Exchange Factor Directly Activated by cAMP 1, Exchange Protein Directly Activated by cAMP 1, Rap1 Guanine-nucleotide-exchange Factor Directly Activated by cAMP, cAMP-regulated Guanine

Sign In for Pricing
View Details
RAPGEF3 (CGEF1, EPAC, EPAC1, Rap Guanine Nucleotide Exchange Factor 3, Exchange Factor Directly Activated by cAMP 1, Exchange Protein Directly Activated by cAMP 1, Rap1 Guanine-nucleotide-exchange Factor Directly Activated by cAMP, cAMP-regulated Guanine
MBS6192179-02 5x 0.1 mL

RAPGEF3 (CGEF1, EPAC, EPAC1, Rap Guanine Nucleotide Exchange Factor 3, Exchange Factor Directly Activated by cAMP 1, Exchange Protein Directly Activated by cAMP 1, Rap1 Guanine-nucleotide-exchange Factor Directly Activated by cAMP, cAMP-regulated Guanine

Sign In for Pricing
View Details
PSB-1115 (potassium salt)
HY-103182A 1 Each

PSB-1115 (potassium salt)

Sign In for Pricing
View Details
NTSR2 3'UTR GFP Stable Cell Line
TU066045 1.0 mL

NTSR2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details