Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSCL2 Rabbit pAb (APR21140N)

Product Specifications

Background

This gene encodes the multi-pass transmembrane protein protein seipin. This protein localizes to the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HNRNPUL2 (heterogeneous nuclear ribonucleoprotein U-like 2) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BSCL2 Rabbit pAb (APR21140N) .

Synonyms

BSCL2; GNG3LG; HMN5; PELD; SPG17; seipin

Gene ID

26580

UniProt

Q96G97

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/44kDa/51kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26580

Uniprot URL

https://www.uniprot.org/uniprot/Q96G97

AA Sequence

GSFYYSYMPTVSHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTRGGRIISTSSRSVMLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Type Lectin Domain Family 2 Member D (CLEC2D) Antibody
abx421131-01 50 µg

C-Type Lectin Domain Family 2 Member D (CLEC2D) Antibody

Sign In for Pricing
View Details
C-Type Lectin Domain Family 2 Member D (CLEC2D) Antibody
abx421131-02 100 µg

C-Type Lectin Domain Family 2 Member D (CLEC2D) Antibody

Sign In for Pricing
View Details
Anti-Dibromo-tyrosine Mouse Monoclonal Antibody
56608 1 Each

Anti-Dibromo-tyrosine Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Tau (T175) polyclonal antibody
orb642782-01 25 µL

Tau (T175) polyclonal antibody

Sign In for Pricing
View Details
Tau (T175) polyclonal antibody
orb642782-02 50 μL

Tau (T175) polyclonal antibody

Sign In for Pricing
View Details
Tau (T175) polyclonal antibody
orb642782-03 100 µL

Tau (T175) polyclonal antibody

Sign In for Pricing
View Details