Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BSCL2 Rabbit pAb (APR21140N)

Product Specifications

Background

This gene encodes the multi-pass transmembrane protein protein seipin. This protein localizes to the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HNRNPUL2 (heterogeneous nuclear ribonucleoprotein U-like 2) .

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BSCL2 Rabbit pAb (APR21140N) .

Synonyms

BSCL2; GNG3LG; HMN5; PELD; SPG17; seipin

Gene ID

26580

UniProt

Q96G97

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/44kDa/51kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26580

Uniprot URL

https://www.uniprot.org/uniprot/Q96G97

AA Sequence

GSFYYSYMPTVSHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTRGGRIISTSSRSVMLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG1 Rabbit Polyclonal Antibody (APC)
orb1000001 100 µL

ABCG1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Lentiviral mouse Dnaja3 shRNA (UAS) - Lentiviral mouse Dnaja3 shRNA (UAS) (25)
GTR15113429 1 Vial

Lentiviral mouse Dnaja3 shRNA (UAS) - Lentiviral mouse Dnaja3 shRNA (UAS) (25)

Sign In for Pricing
View Details
MGluR5 Recombinant Antibody, Cy5.5 Conjugated
bsm-61218R-Cy5.5 100 µL

MGluR5 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Nae1 Antibody - C-terminal region
ARP59379_P050-25UL 25 µL

Nae1 Antibody - C-terminal region

Sign In for Pricing
View Details
Melittin TFA
MBS5817650 Inquire

Melittin TFA

Sign In for Pricing
View Details
LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (PE)
MBS6184143-01 0.1 mL

LEF1 (Lymphoid Enhancer-Binding Factor 1, DKFZp586H0919, TCF1ALPHA) (PE)

Sign In for Pricing
View Details