Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Γ-Tubulin Rabbit pAb (APR21111N)

Product Specifications

Background

This gene encodes a member of the tubulin superfamily. The encoded protein localizes to the centrosome where it binds to microtubules as part of a complex referred to as the gamma-tubulin ring complex. The protein mediates microtubule nucleation and is required for microtubule formation and progression of the cell cycle. A pseudogene of this gene is found on chromosome 7.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality γ-Tubulin Rabbit pAb (APR21107N4) .

Synonyms

TUBG1; CDCBM4; GCP-1; TUBG; TUBGCP1

Gene ID

7283

UniProt

P23258

Cellular Locus

Cytoplasm, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa Observed MW: 51kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7283

Uniprot URL

https://www.uniprot.org/uniprot/P23258

AA Sequence

PWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFERTCRQYDKLRKREAFLEQFRKEDMFKDNFDEMDTSREIVQQLIDEYHAATRPDYISWGTQE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bin2 3'UTR Luciferase Stable Cell Line
TU201333 1.0 mL

Bin2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZNF423 (Zinc Finger Protein 423, Olf1/EBF-Associated Zinc Finger Protein, hOAZ, Smad-and Olf-interacting Zinc Finger Protein, ZNF423, KIAA0760, NPHP14, OAZ) (AP)
MBS6460562-01 0.2 mL

ZNF423 (Zinc Finger Protein 423, Olf1/EBF-Associated Zinc Finger Protein, hOAZ, Smad-and Olf-interacting Zinc Finger Protein, ZNF423, KIAA0760, NPHP14, OAZ) (AP)

Sign In for Pricing
View Details
ZNF423 (Zinc Finger Protein 423, Olf1/EBF-Associated Zinc Finger Protein, hOAZ, Smad-and Olf-interacting Zinc Finger Protein, ZNF423, KIAA0760, NPHP14, OAZ) (AP)
MBS6460562-02 5x 0.2 mL

ZNF423 (Zinc Finger Protein 423, Olf1/EBF-Associated Zinc Finger Protein, hOAZ, Smad-and Olf-interacting Zinc Finger Protein, ZNF423, KIAA0760, NPHP14, OAZ) (AP)

Sign In for Pricing
View Details
Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (ATIC) Chicken ELISA Kit
B8791 96 Tests

Bifunctional purine biosynthesis protein PURH [Includes: Phosphoribosylaminoimidazolecarboxamide formyltransferase (ATIC) Chicken ELISA Kit

Sign In for Pricing
View Details
EWS (C-9) Alexa Fluor® 680
sc-48404 AF680 200 µg/mL

EWS (C-9) Alexa Fluor® 680

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium ATP synthase subunit beta (atpD)
MBS1312409-01 0.02 mg (E-Coli)

Recombinant Salmonella typhimurium ATP synthase subunit beta (atpD)

Sign In for Pricing
View Details