Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASH2L Rabbit pAb (APR21100N)

Product Specifications

Background

Transcriptional regulator. Component or associated component of some histone methyltransferase complexes which regulates transcription through recruitment of those complexes to gene promoters. Component of the Set1/Ash2 histone methyltransferase (HMT complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. May play a role in hematopoiesis. In association with RBBP5 and WDR5, stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A and SETD1B.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ASH2L Rabbit pAb (APR21100N) .

Synonyms

ASH2L; ASH2; ASH2L1; ASH2L2; Bre2

Gene ID

9070

UniProt

Q9UBL3

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/60kDa/68kDa Observed MW: 69kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9070

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBL3

AA Sequence

NLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D10A Rabbit pAb, AP conjugated
orb2890792 100 µL

TBC1D10A Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
IGHV3OR16-13 ORF Vector (Human) (pORF)
24485011 1.0 µg DNA

IGHV3OR16-13 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
FAM113A shRNA Plasmid (m)
sc-145018-SH 20 µg

FAM113A shRNA Plasmid (m)

Sign In for Pricing
View Details
myosin light chain 1 (MYL1) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
TA810681 100 µL

myosin light chain 1 (MYL1) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

Sign In for Pricing
View Details
Lentiviral mouse Ift52 shRNA (UAS) - Lentiviral mouse Ift52 shRNA (UAS, RFP) plasmid
GTR15167329 1 Vial

Lentiviral mouse Ift52 shRNA (UAS) - Lentiviral mouse Ift52 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human LCP1 (Lymphocyte Cytosolic Protein 1) ELISA Kit
MBS8801852-01 48 Well

Human LCP1 (Lymphocyte Cytosolic Protein 1) ELISA Kit

Sign In for Pricing
View Details