Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (APR21093N)

Product Specifications

Background

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (APR21087N5) .

Synonyms

GSS; GSHS; HEL-S-64p; HEL-S-88n

Gene ID

2937

UniProt

P48637

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/52kDa Observed MW: 52KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2937

Uniprot URL

https://www.uniprot.org/uniprot/P48637

AA Sequence

NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BZW1P2 Human qPCR Primer Pair
HP220948 200 Reactions

BZW1P2 Human qPCR Primer Pair

Sign In for Pricing
View Details
Human Semaphorin 3A Recombinant Protein C-6 His Tag Lyophilized
MBS8433355 Inquire

Human Semaphorin 3A Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
FLRT3 protein
80R-4349 50 ug

FLRT3 protein

Sign In for Pricing
View Details
Mouse SCAMP5 shRNA Plasmid
abx974914-01 150 µg

Mouse SCAMP5 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SCAMP5 shRNA Plasmid
abx974914-02 300 µg

Mouse SCAMP5 shRNA Plasmid

Sign In for Pricing
View Details
Bovine Salivary Duct Autoantibody ELISA Kit
OM621042 96 Strip Well

Bovine Salivary Duct Autoantibody ELISA Kit

Sign In for Pricing
View Details