Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSHB Rabbit pAb (APR21090N)

Product Specifications

Background

The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FSHB Rabbit pAb (APR21087N2) .

Synonyms

FSHB; HH24

Gene ID

2488

UniProt

P01225

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2488

Uniprot URL

https://www.uniprot.org/uniprot/P01225

AA Sequence

NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAB39L (NM_030925) Human Tagged ORF Clone
RC203394 10 µg

CAB39L (NM_030925) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Desulfovibrio desulfuricans Undecaprenyl-diphosphatase (uppP)
MBS1070033 Inquire

Recombinant Desulfovibrio desulfuricans Undecaprenyl-diphosphatase (uppP)

Sign In for Pricing
View Details
HIST1H2AK, NT (HIST1H2AG, H2AFP, Histone H2A type 1, Histone H2A/p) (MaxLight 405) discontinued
036589-ML405 100 µL

HIST1H2AK, NT (HIST1H2AG, H2AFP, Histone H2A type 1, Histone H2A/p) (MaxLight 405) discontinued

Sign In for Pricing
View Details
C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (Not for Export EU) discontinued
C7907-04D 100 µL

C-Reactive Protein (CRP, MGC88244, PTX 1, PTX1) (Not for Export EU) discontinued

Sign In for Pricing
View Details
Rhinovirus 1A Genome Polyprotein, Recombinant, Human, aa571-857, His-Tag
375055-01 20 µg

Rhinovirus 1A Genome Polyprotein, Recombinant, Human, aa571-857, His-Tag

Sign In for Pricing
View Details
Rhinovirus 1A Genome Polyprotein, Recombinant, Human, aa571-857, His-Tag
375055-02 100 µg

Rhinovirus 1A Genome Polyprotein, Recombinant, Human, aa571-857, His-Tag

Sign In for Pricing
View Details