Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclin A1 Rabbit pAb (APR21086N)

Product Specifications

Background

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cyclin A1 Rabbit pAb (APR21086N) .

Synonyms

CCNA1; CT146; cyclin-A1

Gene ID

8900

UniProt

P78396

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 47kDa/52kDa Observed MW: 52kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8900

Uniprot URL

https://www.uniprot.org/uniprot/P78396

AA Sequence

YLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2129871-01 0.1 mL

APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2129871-02 0.2 mL

APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2129871-03 0.5 mL

APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2129871-04 1 mL

APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2129871-05 5 mL

APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details
APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)
MBS2129871-06 5x 5 mL

APC_Cy7 Linked Monoclonal Antibody to Brain Natriuretic Peptide (BNP)

Sign In for Pricing
View Details