Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMOD2 Rabbit pAb (APR21081N)

Product Specifications

Background

This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ELMOD2 Rabbit pAb (APR21076N4) .

Synonyms

ELMOD2; 9830169G11Rik

Gene ID

255520

UniProt

Q8IZ81

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=255520

Uniprot URL

https://www.uniprot.org/uniprot/Q8IZ81

AA Sequence

LWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNINPEKDASFKICM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep SDC4 (Syndecan 4) ELISA Kit
MBS2504882-01 24 Tests

Sheep SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Sheep SDC4 (Syndecan 4) ELISA Kit
MBS2504882-02 48 Tests

Sheep SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Sheep SDC4 (Syndecan 4) ELISA Kit
MBS2504882-03 96 Tests

Sheep SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Sheep SDC4 (Syndecan 4) ELISA Kit
MBS2504882-04 5x 96 Tests

Sheep SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Sheep SDC4 (Syndecan 4) ELISA Kit
MBS2504882-05 10x 96 Tests

Sheep SDC4 (Syndecan 4) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Reg3b Protein, N-GST & C-His
E55P6102 50 µg

Recombinant Mouse Reg3b Protein, N-GST & C-His

Sign In for Pricing
View Details