Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POMGNT2 Rabbit pAb (APR21074N)

Product Specifications

Background

This gene encodes a protein with glycosyltransferase activity although its function is not currently known.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality POMGNT2 Rabbit pAb (APR21065N8) .

Synonyms

POMGNT2; AGO61; C3orf39; GTDC2; MDDGA8

Gene ID

84892

UniProt

Q8NAT1

Cellular Locus

Endoplasmic reticulum membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 66kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84892

Uniprot URL

https://www.uniprot.org/uniprot/Q8NAT1

AA Sequence

NPDNLMHVFHDDLLPLFYTLRQFPGLAHEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLKTLGRLLCFSHAFVGLSKITTWYQYGFVQPQGPKANILVSGNEIRQFARFMTEKLNVSHTGVPLGEEYILVFSRTQNRLILNEAELLLALAQEFQMKTVTVSLEDHTFADVVRLVSNASM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibronectin Coated Culture Ware - 384 wells 5 plates/pack
cAP-5001-w384 1 Pack

Human Fibronectin Coated Culture Ware - 384 wells 5 plates/pack

Sign In for Pricing
View Details
PHR1 (PLEKHB1) (NM_001130033) Human 3' UTR Clone
SC213342 10 µg

PHR1 (PLEKHB1) (NM_001130033) Human 3' UTR Clone

Sign In for Pricing
View Details
Ribonuclease P protein subunit p20 (POP7) Mouse ELISA Kit
G7858 96 Tests

Ribonuclease P protein subunit p20 (POP7) Mouse ELISA Kit

Sign In for Pricing
View Details
PCDHAC2 Protein Vector (Human) (pPB-N-His)
PV109931 500 ng

PCDHAC2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Monoclonal CBF2 Antibody (PCRP-CEBPZ-2D8) [Janelia Fluor 549]
NBP3-27044JF549 0.1 mL

Mouse Monoclonal CBF2 Antibody (PCRP-CEBPZ-2D8) [Janelia Fluor 549]

Sign In for Pricing
View Details
Sik3 sgRNA CRISPR Lentivector set (Mouse)
K4655501 3x 1.0 µg

Sik3 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details