Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHR Rabbit pAb (APR21065N)

Product Specifications

Background

The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality AHR Rabbit pAb (APR21065N) .

Synonyms

AHR; bHLHe76

Gene ID

196

UniProt

P35869

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (unknow, Mus musculus, Homo sapiens, Sus scrofa)

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 96kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=196

Uniprot URL

https://www.uniprot.org/uniprot/P35869

AA Sequence

LEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFVPFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYPMGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFPDLTSSGFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKIB Antibody, FITC conjugated
CSB-PA883651LC01HU-01 50 µg

PKIB Antibody, FITC conjugated

Sign In for Pricing
View Details
PKIB Antibody, FITC conjugated
CSB-PA883651LC01HU-02 100 µg

PKIB Antibody, FITC conjugated

Sign In for Pricing
View Details
OR8D1 Antibody - C-terminal region : HRP (ARP71210_P050-HRP)
ARP71210_P050-HRP 100 µL

OR8D1 Antibody - C-terminal region : HRP (ARP71210_P050-HRP)

Sign In for Pricing
View Details
Anti-Human CYTH1 Polyclonal Antibody
HS818014-01 50 µg

Anti-Human CYTH1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CYTH1 Polyclonal Antibody
HS818014-02 100 µg

Anti-Human CYTH1 Polyclonal Antibody

Sign In for Pricing
View Details
Tnmd Mouse shRNA Plasmid (Locus ID 64103)
TL515145 1 Kit

Tnmd Mouse shRNA Plasmid (Locus ID 64103)

Sign In for Pricing
View Details