Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NGDN Rabbit pAb (APR21064N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NGDN Rabbit pAb (APR21064N) .

Synonyms

NGDN; C14orf120; CANu1; LCP5; NGD; lpd-2

Gene ID

25983

UniProt

Q8NEJ9

Cellular Locus

Cell projection, Chromosome, Cytoplasm, Nucleus, axon, centromere, dendrite, filopodium, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: Refer to Figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=25983

Uniprot URL

https://www.uniprot.org/uniprot/Q8NEJ9

AA Sequence

LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTGSLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVHYDETEAEREKKRLERAKRRALSSSVIREL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPL Polyclonal Antibody
MBS9433900-01 0.05 mL

PPL Polyclonal Antibody

Sign In for Pricing
View Details
PPL Polyclonal Antibody
MBS9433900-02 0.1 mL

PPL Polyclonal Antibody

Sign In for Pricing
View Details
PPL Polyclonal Antibody
MBS9433900-03 5x 0.1 mL

PPL Polyclonal Antibody

Sign In for Pricing
View Details
Human LOC653631 Protein Lysate
MBS8414613-01 0.02 mg

Human LOC653631 Protein Lysate

Sign In for Pricing
View Details
Human LOC653631 Protein Lysate
MBS8414613-02 5x 0.02 mg

Human LOC653631 Protein Lysate

Sign In for Pricing
View Details
ERCC8, ID (ERCC8, CKN1, CSA, DNA excision repair protein ERCC-8, Cockayne syndrome WD repeat protein CSA) (AP) discontinued
035198-AP 200 µL

ERCC8, ID (ERCC8, CKN1, CSA, DNA excision repair protein ERCC-8, Cockayne syndrome WD repeat protein CSA) (AP) discontinued

Sign In for Pricing
View Details