Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCSTN Rabbit pAb (APR21060N)

Product Specifications

Background

This gene encodes a type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be a stabilizing cofactor required for gamma-secretase complex assembly. The cleavage of beta-amyloid precursor protein yields amyloid beta peptide, the main component of the neuritic plaque and the hallmark lesion in the brains of patients with Alzheimer's disease; however, the nature of the encoded protein's role in Alzheimer's disease is not known for certain. Mutations in this gene are associated with familial acne inversa. A pseudogene of this gene is present on chromosome 21. Alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NCSTN Rabbit pAb (APR21060N) .

Synonyms

NCSTN; ATAG1874; nicastrin

Gene ID

23385

UniProt

Q92542

Cellular Locus

Melanosome, Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 76kDa/78kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23385

Uniprot URL

https://www.uniprot.org/uniprot/Q92542

AA Sequence

RFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B12]
TA500446BM 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B12]

Ask
View Details
4-Isopropylbenzoic Acid Cumic acid, 98.0% Cuminic acid Cell Culture Tested
TC1539-01 5 g

4-Isopropylbenzoic Acid Cumic acid, 98.0% Cuminic acid Cell Culture Tested

Ask
View Details
4-Isopropylbenzoic Acid Cumic acid, 98.0% Cuminic acid Cell Culture Tested
TC1539-02 25 g

4-Isopropylbenzoic Acid Cumic acid, 98.0% Cuminic acid Cell Culture Tested

Ask
View Details
HLA-DMA (HLA Class II Histocompatibility Antigen, DM alpha Chain, MHC Class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) (HRP)
127903-HRP 100 µL

HLA-DMA (HLA Class II Histocompatibility Antigen, DM alpha Chain, MHC Class II Antigen DMA, Really Interesting New Gene 6 Protein, DMA, RING6) (HRP)

Ask
View Details
SHOC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43727064 1.0 µg DNA

SHOC2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Ask
View Details
Anti-5T4 antibody (DM138), Rabbit mAb
MBS188907-01 0.01 mg

Anti-5T4 antibody (DM138), Rabbit mAb

Ask
View Details