Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBX1 Rabbit pAb (APR21055N)

Product Specifications

Background

This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBX1 Rabbit pAb (APR21055N) .

Synonyms

RBX1; BA554C12.1; RNF75; ROC1

Gene ID

9978

UniProt

P62877

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9978

Uniprot URL

https://www.uniprot.org/uniprot/P62877

AA Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dog CD340/ERBB2/HER2/NEU Protein, N-His
E55P7171 50 µg

Recombinant Dog CD340/ERBB2/HER2/NEU Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Putative transmembrane protein C13orf44 (C13orf44) , partial
MBS7101659 Inquire

Recombinant Human Putative transmembrane protein C13orf44 (C13orf44) , partial

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) Os11g0222200 Polyclonal Antibody
MBS7192879 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os11g0222200 Polyclonal Antibody

Sign In for Pricing
View Details
FGF10 Polyclonal Antibody HRP Conjugated
orb1540966 100 µL

FGF10 Polyclonal Antibody HRP Conjugated

Sign In for Pricing
View Details
FAM27D1 3'UTR Lenti-reporter-Luc Vector
19994081 1.0 µg

FAM27D1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PEnCMV-3xFLAG-FOXP3 (human)
BZ32818 1 Vial

PEnCMV-3xFLAG-FOXP3 (human)

Sign In for Pricing
View Details