Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCR1 Rabbit pAb (APR21054N)

Product Specifications

Background

NKp46, along with NKp30 and NKp44, are activating receptors that have been collectively termed the natural cytotoxicity receptors (NCR) .These receptors lack significant sequence homology to one another. They are expressed almost exclusively by NK cells and play a major role in triggering some of the key lytic activities of NK cells.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NCR1 Rabbit pAb (APR21054N) .

Synonyms

CD335; LY94; NK-p46; NKP46; NCR1

Gene ID

9437

UniProt

O76036

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Applications

IF (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa/22kDa/23kDa/32kDa/34kDa Observed MW: 46kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9437

Uniprot URL

https://www.uniprot.org/uniprot/O76036

AA Sequence

SMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Epstein-Barr Latent membrane protein 1, His, Yeast-100ug
QP7024-ye-100ug 100ug

Recombinant Epstein-Barr Latent membrane protein 1, His, Yeast-100ug

Sign In for Pricing
View Details
Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)
MBS1075957-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)
MBS1075957-02 0.02 mg (Yeast)

Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)
MBS1075957-03 0.1 mg (E-Coli)

Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)
MBS1075957-04 0.1 mg (Yeast)

Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)
MBS1075957-05 0.02 mg (Baculovirus)

Recombinant Bacillus cereus Aspartate carbamoyltransferase (pyrB)

Sign In for Pricing
View Details