Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF2S2 Rabbit pAb (APR21053N)

Product Specifications

Background

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF2S2 Rabbit pAb (APR21053N) .

Synonyms

EIF2S2; EIF2; EIF2B; EIF2beta; PPP1R67; eIF-2-beta

Gene ID

8894

UniProt

P20042

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8894

Uniprot URL

https://www.uniprot.org/uniprot/P20042

AA Sequence

MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FIP1L1 Antibody Picoband® Fluoro550 Conjugated
A02452-1-Fluoro550 100 µg/Vial

Anti-FIP1L1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse BEN domain-containing protein 6 (Bend6)
MBS1371760-01 0.02 mg (E-Coli)

Recombinant Mouse BEN domain-containing protein 6 (Bend6)

Sign In for Pricing
View Details
Recombinant Mouse BEN domain-containing protein 6 (Bend6)
MBS1371760-02 0.02 mg (Yeast)

Recombinant Mouse BEN domain-containing protein 6 (Bend6)

Sign In for Pricing
View Details
Recombinant Mouse BEN domain-containing protein 6 (Bend6)
MBS1371760-03 0.1 mg (E-Coli)

Recombinant Mouse BEN domain-containing protein 6 (Bend6)

Sign In for Pricing
View Details
Recombinant Mouse BEN domain-containing protein 6 (Bend6)
MBS1371760-04 0.1 mg (Yeast)

Recombinant Mouse BEN domain-containing protein 6 (Bend6)

Sign In for Pricing
View Details
Recombinant Mouse BEN domain-containing protein 6 (Bend6)
MBS1371760-05 0.02 mg (Baculovirus)

Recombinant Mouse BEN domain-containing protein 6 (Bend6)

Sign In for Pricing
View Details