Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5R1 Rabbit pAb (APR21052N)

Product Specifications

Background

The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5) ; the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK5R1 Rabbit pAb (APR21052N) .

Synonyms

CDK5R1; CDK5P35; CDK5R; NCK5A; p23; p25; p35; p35nck5a

Gene ID

8851

UniProt

Q15078

Cellular Locus

Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Nucleus, perinuclear region

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 24-35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8851

Uniprot URL

https://www.uniprot.org/uniprot/Q15078

AA Sequence

AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle
RC221382L4V 200 µL

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human A Disintegrin And Metalloprotease 12 ELISA Kit
MBS3802422-01 48 Well

Human A Disintegrin And Metalloprotease 12 ELISA Kit

Ask
View Details
Human A Disintegrin And Metalloprotease 12 ELISA Kit
MBS3802422-02 96 Well

Human A Disintegrin And Metalloprotease 12 ELISA Kit

Ask
View Details
Human A Disintegrin And Metalloprotease 12 ELISA Kit
MBS3802422-03 5x 96 Well

Human A Disintegrin And Metalloprotease 12 ELISA Kit

Ask
View Details
Human A Disintegrin And Metalloprotease 12 ELISA Kit
MBS3802422-04 10x 96 Well

Human A Disintegrin And Metalloprotease 12 ELISA Kit

Ask
View Details
Lentiviral mouse Fabp3 shRNA (UAS) - Lentiviral mouse Fabp3 shRNA (UAS, iRFP) (25)
GTR15289658 1 Vial

Lentiviral mouse Fabp3 shRNA (UAS) - Lentiviral mouse Fabp3 shRNA (UAS, iRFP) (25)

Ask
View Details