Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPARC Rabbit pAb (APR21049N)

Product Specifications

Background

This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPARC Rabbit pAb (APR21049N) .

Synonyms

SPARC; BM-40; OI17

Gene ID

6678

UniProt

P09486

Cellular Locus

Secreted, basement membrane, extracellular matrix, extracellular space

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6678

Uniprot URL

https://www.uniprot.org/uniprot/P09486

AA Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDF-2 Double Nickase Plasmid (h2)
sc-404598-NIC-2 20 µg

SDF-2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
14-3-3 gamma Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-12421R-BF350 100 µL

14-3-3 gamma Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Thyroid Peroxidase Rabbit mAb
orb1924100-01 50 µL

Thyroid Peroxidase Rabbit mAb

Sign In for Pricing
View Details
Thyroid Peroxidase Rabbit mAb
orb1924100-02 100 µL

Thyroid Peroxidase Rabbit mAb

Sign In for Pricing
View Details
FA54A Rabbit Polyclonal Antibody
BT-AP09957-01 20 µL

FA54A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FA54A Rabbit Polyclonal Antibody
BT-AP09957-02 50 µL

FA54A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details