Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOZ1 Rabbit pAb (APR21037N)

Product Specifications

Background

The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MYOZ1 Rabbit pAb (APR21037N) .

Synonyms

MYOZ1; CS-2; FATZ; MYOZ

Gene ID

58529

UniProt

Q9NP98

Cellular Locus

Cell projection, Nucleus, pseudopodium

Dilution

WB 1:500 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa Observed MW: 37kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=58529

Uniprot URL

https://www.uniprot.org/uniprot/Q9NP98

AA Sequence

VFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS7 Protein Vector (Rat) (pPB-N-His)
PV252287 500 ng

ADAMTS7 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136968-01 0.1 mL

APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136968-02 0.2 mL

APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136968-03 0.5 mL

APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136968-04 1 mL

APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)
MBS2136968-05 5 mL

APC Linked Polyclonal Antibody to Retinitis Pigmentosa GTPase Regulator Interacting Protein 1 (RPGRIP1)

Sign In for Pricing
View Details