Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Transferrin Rabbit pAb (APR21033N)

Product Specifications

Background

This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Transferrin Rabbit pAb (APR21033N) .

Synonyms

HEL-S-71p; PRO1557; PRO2086; TFQTL1; TF; Transferrin

Gene ID

7018

UniProt

P02787

Cellular Locus

Secreted

Applications

WB (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa Observed MW: 77KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7018

Uniprot URL

https://www.uniprot.org/uniprot/P02787

AA Sequence

KIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BASP1 Antibody (06) [mFluor Violet 450 SE]
NBP3-26901MFV450 0.1 mL

Mouse Monoclonal BASP1 Antibody (06) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
DiagPoly™ Carboxyl Polystyrene Particles, 2.0 µm
DNM-F030 10 mL

DiagPoly™ Carboxyl Polystyrene Particles, 2.0 µm

Sign In for Pricing
View Details
Hsa-miR-6768-3p miRNA Mimic
CMH2200-01 5 nmol

Hsa-miR-6768-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-6768-3p miRNA Mimic
CMH2200-02 10 nmol

Hsa-miR-6768-3p miRNA Mimic

Sign In for Pricing
View Details
4- (Dimethylsulfamoyl) -5-methylfuran-2-carboxylic acid
WVB29471-01 100 mg

4- (Dimethylsulfamoyl) -5-methylfuran-2-carboxylic acid

Sign In for Pricing
View Details
4- (Dimethylsulfamoyl) -5-methylfuran-2-carboxylic acid
WVB29471-02 1 g

4- (Dimethylsulfamoyl) -5-methylfuran-2-carboxylic acid

Sign In for Pricing
View Details