Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Transferrin Rabbit pAb (APR21033N)

Product Specifications

Background

This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Transferrin Rabbit pAb (APR21033N) .

Synonyms

HEL-S-71p; PRO1557; PRO2086; TFQTL1; TF; Transferrin

Gene ID

7018

UniProt

P02787

Cellular Locus

Secreted

Applications

WB (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 77kDa Observed MW: 77KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7018

Uniprot URL

https://www.uniprot.org/uniprot/P02787

AA Sequence

KIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Cyano-3-fluorobenzoic acid
PYB37933-01 100 mg

2-Cyano-3-fluorobenzoic acid

Sign In for Pricing
View Details
2-Cyano-3-fluorobenzoic acid
PYB37933-02 1 g

2-Cyano-3-fluorobenzoic acid

Sign In for Pricing
View Details
G21 protein/NPR2L Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-6079R-BF647 100 µL

G21 protein/NPR2L Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Zbtb1 (NM_001004444) Rat Untagged Clone
RN214461 10 µg

Zbtb1 (NM_001004444) Rat Untagged Clone

Sign In for Pricing
View Details
Monkey Interleukin 36γ
GTR10406887 96 Well

Monkey Interleukin 36γ

Sign In for Pricing
View Details
MKK4 Blocking Peptide
CBP4716-01 1 mg

MKK4 Blocking Peptide

Sign In for Pricing
View Details