Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF597 Rabbit pAb (APR21003N)

Product Specifications

Background

This gene encodes a protein with multiple zinc finger domains. Loss of the related gene in rodents results in defects in neural development and embryonic lethality in mutant homozygotes. This gene is adjacent to a differentially methylated region (DMR) and is imprinted and maternally expressed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF597 Rabbit pAb (APR21003N) .

Synonyms

ZNF597; HIT-4

Gene ID

146434

UniProt

Q96LX8

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=146434

Uniprot URL

https://www.uniprot.org/uniprot/Q96LX8

AA Sequence

MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPEINQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLLVTIENHTPLVELSEYLGTNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Colon: sigmoid
CD563135 5 µg

Tissue Genomic DNA, Colon: sigmoid

Sign In for Pricing
View Details
Gdf2 Rat shRNA Plasmid (Locus ID 290921)
TR704687 1 Kit

Gdf2 Rat shRNA Plasmid (Locus ID 290921)

Sign In for Pricing
View Details
Lentiviral human TRAPPC2B sgRNA gene knockout kit - Lentiviral human TRAPPC2B sgRNA gene knockout kit (plasmid)
GTR15399503 1 Vial

Lentiviral human TRAPPC2B sgRNA gene knockout kit - Lentiviral human TRAPPC2B sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GRIA3 Rabbit pAb
MBS8549290-01 0.1 mL

GRIA3 Rabbit pAb

Sign In for Pricing
View Details
GRIA3 Rabbit pAb
MBS8549290-02 0.1 mL (AF405L)

GRIA3 Rabbit pAb

Sign In for Pricing
View Details
GRIA3 Rabbit pAb
MBS8549290-03 0.1 mL (AF405S)

GRIA3 Rabbit pAb

Sign In for Pricing
View Details