Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTRH1 Rabbit pAb (APR20999N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PTRH1 Rabbit pAb (APR20999N) .

Synonyms

PTRH1; C9orf115; PTH1

Gene ID

138428

UniProt

Q86Y79

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 23kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=138428

Uniprot URL

https://www.uniprot.org/uniprot/Q86Y79

AA Sequence

MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGPSLGP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1A1 Antibody, Biotin conjugated
A12295-50UG 50 µg

AKR1A1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SART1 (U4/U6U5 tri-snRNP-Associated Protein 1, SNU66 Homolog, hSnu66, Squamous Cell Carcinoma antigen Recognized by T-Cells 1, SART-1, hSART-1, U4/U6U5 tri-snRNP-Associated 110kD Protein, Hom s 1, SART1) (APC)
MBS6459067-01 0.1 mL

SART1 (U4/U6U5 tri-snRNP-Associated Protein 1, SNU66 Homolog, hSnu66, Squamous Cell Carcinoma antigen Recognized by T-Cells 1, SART-1, hSART-1, U4/U6U5 tri-snRNP-Associated 110kD Protein, Hom s 1, SART1) (APC)

Sign In for Pricing
View Details
SART1 (U4/U6U5 tri-snRNP-Associated Protein 1, SNU66 Homolog, hSnu66, Squamous Cell Carcinoma antigen Recognized by T-Cells 1, SART-1, hSART-1, U4/U6U5 tri-snRNP-Associated 110kD Protein, Hom s 1, SART1) (APC)
MBS6459067-02 5x 0.1 mL

SART1 (U4/U6U5 tri-snRNP-Associated Protein 1, SNU66 Homolog, hSnu66, Squamous Cell Carcinoma antigen Recognized by T-Cells 1, SART-1, hSART-1, U4/U6U5 tri-snRNP-Associated 110kD Protein, Hom s 1, SART1) (APC)

Sign In for Pricing
View Details
Human Tomoregulin 1 (TR1) Antibody Pair Kit (with Standard)
MBS2104398-01 5x 96 Tests

Human Tomoregulin 1 (TR1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Tomoregulin 1 (TR1) Antibody Pair Kit (with Standard)
MBS2104398-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Tomoregulin 1 (TR1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Tomoregulin 1 (TR1) Antibody Pair Kit (with Standard)
MBS2104398-03 10x 96 Tests

Human Tomoregulin 1 (TR1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details