Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V1G3 Rabbit pAb (APR20994N)

Product Specifications

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATP6V1G3 Rabbit pAb (APR20994N) .

Synonyms

ATP6V1G3; ATP6G3; Vma10

Gene ID

127124

UniProt

Q96LB4

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 6kDa/13kDa/14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=127124

Uniprot URL

https://www.uniprot.org/uniprot/Q96LB4

AA Sequence

MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG12 (ATG12, APG12, APG12L, Ubiquitin-like protein ATG12, Autophagy-related protein 12) (PE) discontinued
030788-PE 200 µL

ATG12 (ATG12, APG12, APG12L, Ubiquitin-like protein ATG12, Autophagy-related protein 12) (PE) discontinued

Request Quote
View Details
Rabbit Anti-Hamster IgG (H&L) - HRP
CSA2182-01 100 µL

Rabbit Anti-Hamster IgG (H&L) - HRP

Request Quote
View Details
Rabbit Anti-Hamster IgG (H&L) - HRP
CSA2182-02 500 μL

Rabbit Anti-Hamster IgG (H&L) - HRP

Request Quote
View Details
Rabbit Anti-Hamster IgG (H&L) - HRP
CSA2182-03 1 mL

Rabbit Anti-Hamster IgG (H&L) - HRP

Request Quote
View Details
B-Raf Kinase (BRAF, Ras effector) (MaxLight 550)
MBS6465853-01 0.1 mL

B-Raf Kinase (BRAF, Ras effector) (MaxLight 550)

Request Quote
View Details
B-Raf Kinase (BRAF, Ras effector) (MaxLight 550)
MBS6465853-02 5x 0.1 mL

B-Raf Kinase (BRAF, Ras effector) (MaxLight 550)

Request Quote
View Details