Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V1G3 Rabbit pAb (APR20994N)

Product Specifications

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATP6V1G3 Rabbit pAb (APR20994N) .

Synonyms

ATP6V1G3; ATP6G3; Vma10

Gene ID

127124

UniProt

Q96LB4

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 6kDa/13kDa/14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=127124

Uniprot URL

https://www.uniprot.org/uniprot/Q96LB4

AA Sequence

MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SPANXA1 (Sperm Protein Associated with the nucleus on the X Chromosome A, Cancer/Testis antigen 111, CT111, Nuclear-Associated Protein SPAN-Xa, SPAN-X, SPANX-A, SPANX Family Member A, SPANXA1, SPANXA) (MaxLight 490) discontinued
302765-ML490 100 µL

SPANXA1 (Sperm Protein Associated with the nucleus on the X Chromosome A, Cancer/Testis antigen 111, CT111, Nuclear-Associated Protein SPAN-Xa, SPAN-X, SPANX-A, SPANX Family Member A, SPANXA1, SPANXA) (MaxLight 490) discontinued

Ask
View Details
RAB40A Rabbit Polyclonal Antibody
TA340254 100 µL

RAB40A Rabbit Polyclonal Antibody

Ask
View Details
Anti-Beclin-1 antibody
STJ97474 200 µl

Anti-Beclin-1 antibody

Ask
View Details
VASH2 (NM_001136475) Human Tagged ORF Clone
RC227908 10 µg

VASH2 (NM_001136475) Human Tagged ORF Clone

Ask
View Details
Rabbit Polyclonal LOK Antibody [DyLight 550]
NBP2-99860R 0.1 mL

Rabbit Polyclonal LOK Antibody [DyLight 550]

Ask
View Details
Polyclonal Antibody to GPR18
11-8041-100 100 µg

Polyclonal Antibody to GPR18

Ask
View Details