Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V1G3 Rabbit pAb (APR20994N)

Product Specifications

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'' and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene encodes one of three G subunit proteins. Transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ATP6V1G3 Rabbit pAb (APR20994N) .

Synonyms

ATP6V1G3; ATP6G3; Vma10

Gene ID

127124

UniProt

Q96LB4

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 6kDa/13kDa/14kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=127124

Uniprot URL

https://www.uniprot.org/uniprot/Q96LB4

AA Sequence

MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse TMEM261 shRNA Plasmid
abx975865-01 150 µg

Mouse TMEM261 shRNA Plasmid

Ask
View Details
Mouse TMEM261 shRNA Plasmid
abx975865-02 300 µg

Mouse TMEM261 shRNA Plasmid

Ask
View Details
Recombinant Mouse PDHA1 Protein, N-His
E55P8184 50 µg

Recombinant Mouse PDHA1 Protein, N-His

Ask
View Details
PIK3C2B (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit beta, PI3K-C2-beta, Phosphoinositide 3-kinase-C2-beta, PIK3C2B, PtdIns-3-kinase C2 Subunit beta, C2-PI3K, DKFZp686G16234) (FITC)
MBS6148862-01 0.1 mL

PIK3C2B (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit beta, PI3K-C2-beta, Phosphoinositide 3-kinase-C2-beta, PIK3C2B, PtdIns-3-kinase C2 Subunit beta, C2-PI3K, DKFZp686G16234) (FITC)

Ask
View Details
PIK3C2B (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit beta, PI3K-C2-beta, Phosphoinositide 3-kinase-C2-beta, PIK3C2B, PtdIns-3-kinase C2 Subunit beta, C2-PI3K, DKFZp686G16234) (FITC)
MBS6148862-02 5x 0.1 mL

PIK3C2B (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit beta, PI3K-C2-beta, Phosphoinositide 3-kinase-C2-beta, PIK3C2B, PtdIns-3-kinase C2 Subunit beta, C2-PI3K, DKFZp686G16234) (FITC)

Ask
View Details
WDR42A (DCAF8) (NM_015726) Human Over-expression Lysate
LH09787V 100 µg

WDR42A (DCAF8) (NM_015726) Human Over-expression Lysate

Ask
View Details