Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMA1 Rabbit pAb (APR20988N)

Product Specifications

Background

Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Activated in response to various mitochondrial stress, leading to the proteolytic cleavage of target proteins, such as OPA1, UQCC3 and DELE1. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Also acts as a regulator of apoptosis: upon BAK and BAX aggregation, mediates cleavage of OPA1, leading to the remodeling of mitochondrial cristae and allowing the release of cytochrome c from mitochondrial cristae. In depolarized mitochondria, may also act as a backup protease for PINK1 by mediating PINK1 cleavage and promoting its subsequent degradation by the proteasome. May also cleave UQCC3 in response to mitochondrial depolarization. Also acts as an activator of the integrated stress response (ISR: in response to mitochondrial stress, mediates cleavage of DELE1 to generate the processed form of DELE1 (S-DELE1, which translocates to the cytosol and activates EIF2AK1/HRI to trigger the ISR. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions (By similarity. Binds cardiolipin, possibly regulating its protein turnover (By similarity. Required for the stability of the respiratory supercomplexes (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OMA1 Rabbit pAb (APR20988N) .

Synonyms

OMA1; 2010001O09Rik; DAB1; MPRP-1; MPRP1; YKR087C; ZMPOMA1; peptidase

Gene ID

115209

UniProt

Q96E52

Cellular Locus

Mitochondrion inner membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 55kDa/60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=115209

Uniprot URL

https://www.uniprot.org/uniprot/Q96E52

AA Sequence

AICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MCM6 Rabbit Monoclonal Antibody
E56G5069 100 µL

MCM6 Rabbit Monoclonal Antibody

Ask
View Details
C4orf44 (MSANTD1) Human shRNA Lentiviral Particle (Locus ID 345222)
TL315225V 500 µL Each

C4orf44 (MSANTD1) Human shRNA Lentiviral Particle (Locus ID 345222)

Ask
View Details
Vascular Endothelial Growth Factor A (VEGFA) BioAssayTM ELISA Kit (Rabbit)
028828 96 Tests

Vascular Endothelial Growth Factor A (VEGFA) BioAssayTM ELISA Kit (Rabbit)

Ask
View Details
Lentiviral mouse 1700102P08Rik shRNA (UAS) - Lentiviral mouse 1700102P08Rik shRNA (UAS, iRFP) (100)
GTR15173571 1 Vial

Lentiviral mouse 1700102P08Rik shRNA (UAS) - Lentiviral mouse 1700102P08Rik shRNA (UAS, iRFP) (100)

Ask
View Details
DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (Biotin)
MBS6452259-01 0.1 mL

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (Biotin)

Ask
View Details
DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (Biotin)
MBS6452259-02 5x 0.1 mL

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (Biotin)

Ask
View Details