Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPP21 Rabbit pAb (APR20974N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPP21 Rabbit pAb (APR20974N) .

Synonyms

RPP21; C6orf135; CAT60

Gene ID

79897

UniProt

Q9H633

Cellular Locus

Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/17kDa/18kDa/20kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79897

Uniprot URL

https://www.uniprot.org/uniprot/Q9H633

AA Sequence

MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQGSSNQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human DPEP3 shRNA (UAS) - Lentiviral human DPEP3 shRNA (UAS, iRFP) (100)
GTR15103659 1 Vial

Lentiviral human DPEP3 shRNA (UAS) - Lentiviral human DPEP3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (AP)
MBS6373829-01 0.1 mL

CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (AP)

Sign In for Pricing
View Details
CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (AP)
MBS6373829-02 5x 0.1 mL

CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (AP)

Sign In for Pricing
View Details
Human HMGN2 Pre-designed siRNA Set B
SI007134B 1 Each

Human HMGN2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Fish Dicarbonyl/L-Xylulose Reductase (DCXR) ELISA Kit
MBS9914242 Inquire

Fish Dicarbonyl/L-Xylulose Reductase (DCXR) ELISA Kit

Sign In for Pricing
View Details
JAM-B antibody
22452 100 µL

JAM-B antibody

Sign In for Pricing
View Details