Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G2E3 Rabbit pAb (APR20960N)

Product Specifications

Background

E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Essential in early embryonic development to prevent apoptotic death.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality G2E3 Rabbit pAb (APR20960N) .

Synonyms

G2E3; KIAA1333; PHF7B

Gene ID

55632

UniProt

Q7L622

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 80kDa Observed MW: 80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55632

Uniprot URL

https://www.uniprot.org/uniprot/Q7L622

AA Sequence

MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Elongin A ELISA Kit
MBS750855-01 48 Well

Chicken Elongin A ELISA Kit

Sign In for Pricing
View Details
Chicken Elongin A ELISA Kit
MBS750855-02 96 Well

Chicken Elongin A ELISA Kit

Sign In for Pricing
View Details
Chicken Elongin A ELISA Kit
MBS750855-03 5x 96 Well

Chicken Elongin A ELISA Kit

Sign In for Pricing
View Details
Chicken Elongin A ELISA Kit
MBS750855-04 10x 96 Well

Chicken Elongin A ELISA Kit

Sign In for Pricing
View Details
ZNF516 Rabbit Polyclonal Antibody (APC-Cy7)
orb1573637 100 µL

ZNF516 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
pCMV-SPORT6-SP140L Plasmid
PVT35290 2 µg

pCMV-SPORT6-SP140L Plasmid

Sign In for Pricing
View Details