Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF181 Rabbit pAb (APR20956N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RNF181 Rabbit pAb (APR20951N5) .

Synonyms

RNF181; HSPC238

Gene ID

51255

UniProt

Q9P0P0

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51255

Uniprot URL

https://www.uniprot.org/uniprot/Q9P0P0

AA Sequence

MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVENLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX4 (Center) Rabbit pAb
E2614041 100 µL

STX4 (Center) Rabbit pAb

Sign In for Pricing
View Details
Monkey Tyrosine Kinase ELISA kit
GTR10446487 96 Well

Monkey Tyrosine Kinase ELISA kit

Sign In for Pricing
View Details
AIFM1 Recombinant Protein
32-3173-20 20 µg

AIFM1 Recombinant Protein

Sign In for Pricing
View Details
NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (FITC) discontinued
038852-FITC 200 µL

NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (FITC) discontinued

Sign In for Pricing
View Details
IL22 rabbit polyclonal antibody, Biotin
PP1224B1 25 µg

IL22 rabbit polyclonal antibody, Biotin

Sign In for Pricing
View Details
AP4S1 (NM_001128126) Human Tagged ORF Clone
RC225121 10 µg

AP4S1 (NM_001128126) Human Tagged ORF Clone

Sign In for Pricing
View Details