Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM2 Rabbit pAb (APR20944N)

Product Specifications

Background

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic filaments. It plays a neuroprotective role and functions as an E3-ubiquitin ligase in proteasome-mediated degradation of target proteins. Mutations in this gene can cause early-onset axonal neuropathy. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIM2 Rabbit pAb (APR20944N) .

Synonyms

TRIM2; CMT2R; RNF86

Gene ID

23321

UniProt

Q9C040

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 81kDa/84kDa Observed MW: 81kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23321

Uniprot URL

https://www.uniprot.org/uniprot/Q9C040

AA Sequence

GVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Serum Albumin Antibody (YA986)
HY-P81281B 1 Each

Human Serum Albumin Antibody (YA986)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial
MBS1064450-01 0.5 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial
MBS1064450-02 0.05 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial
MBS1064450-03 0.5 mg (Yeast)

Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial
MBS1064450-04 0.05 mg (Mammalian-Cell)

Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial
MBS1064450-05 1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Chitin synthase regulatory factor 2 (chr2), partial

Sign In for Pricing
View Details