Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ12 Rabbit pAb (APR20924N)

Product Specifications

Background

This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1) . The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality KCNJ12 Rabbit pAb (APR20924N) .

Synonyms

KCNJ12; IRK-2; IRK2; KCNJN1; Kir2.2; Kir2.2v; hIRK; hIRK1; hkir2.2x; kcnj12x

Gene ID

3768

UniProt

Q14500

Cellular Locus

Cell membrane, Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3768

Uniprot URL

https://www.uniprot.org/uniprot/Q14500

AA Sequence

TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy Lansoprazole Sulfide
TRC-H943715-50MG 50 mg

5-Hydroxy Lansoprazole Sulfide

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF568 conjugate, 0.1mg/mL
BNC682406-500 1x 500 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAIM Polyclonal Antibody
E-AB-90022-01 60 µL

FAIM Polyclonal Antibody

Sign In for Pricing
View Details
FAIM Polyclonal Antibody
E-AB-90022-02 120 µL

FAIM Polyclonal Antibody

Sign In for Pricing
View Details
FAIM Polyclonal Antibody
E-AB-90022-03 200 µL

FAIM Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS703384 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details