Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PREPL Rabbit pAb (APR20897N)

Product Specifications

Background

The protein encoded by this gene belongs to the prolyl oligopeptidase subfamily of serine peptidases. Mutations in this gene have been associated with hypotonia-cystinuria syndrome, also known as the 2p21 deletion syndrome. Several alternatively spliced transcript variants encoding either the same or different isoforms have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PREPL Rabbit pAb (APR20897N) .

Synonyms

PREPL; CMS22

Gene ID

9581

UniProt

Q4J6C6

Cellular Locus

Cytoplasm, cytosol

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 73kDa/76kDa/83kDa Observed MW: 72kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9581

Uniprot URL

https://www.uniprot.org/uniprot/Q4J6C6

AA Sequence

AVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)
MBS2040723-01 0.1 mL

FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)
MBS2040723-02 0.2 mL

FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)
MBS2040723-03 0.5 mL

FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)
MBS2040723-04 1 mL

FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)
MBS2040723-05 5 mL

FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)
MBS2040723-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Neuronal Pentraxin II (NPTX2)

Sign In for Pricing
View Details