Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PREB Rabbit pAb (APR20896N)

Product Specifications

Background

This gene encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p. This gene overlaps the abhydrolase domain containing 1 (ABHD1) gene on the opposite strand.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PREB Rabbit pAb (APR20896N) .

Synonyms

PREB; SEC12

Gene ID

10113

UniProt

Q9HCU5

Cellular Locus

Endoplasmic reticulum membrane, Nucleus, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10113

Uniprot URL

https://www.uniprot.org/uniprot/Q9HCU5

AA Sequence

PFPLYALQVDPSTGLLIAAGGGGAAKTGIKNGVHFLQLELINGRLSASLLHSHDTETRATMNLALAGDILAAGQDAHCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIEDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)
MBS1297766-01 0.02 mg (E-Coli)

Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)
MBS1297766-02 0.1 mg (E-Coli)

Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)
MBS1297766-03 0.02 mg (Yeast)

Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)
MBS1297766-04 0.1 mg (Yeast)

Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)
MBS1297766-05 0.02 mg (Baculovirus)

Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)

Sign In for Pricing
View Details
Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)
MBS1297766-06 0.02 mg (Mammalian-Cell)

Recombinant Microplitis demolitor bracovirus I-Kappa-B like protein G1 (G3)

Sign In for Pricing
View Details