Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF157 Rabbit pAb (APR20872N)

Product Specifications

Background

This gene product is a likely zinc finger family transcription factor. It contains KRAB-A and KRAB-B domains that act as transcriptional repressors in related proteins, and multiple zinc finger DNA binding motifs and finger linking regions characteristic of the Kruppel family. This gene is part of a gene cluster on chromosome Xp11.23.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ZNF157 Rabbit pAb (APR20872N) .

Synonyms

ZNF157; HZF22

Gene ID

7712

UniProt

P51786

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 58kDa Observed MW: 58kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7712

Uniprot URL

https://www.uniprot.org/uniprot/P51786

AA Sequence

VAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD2 Antibody (HuLy-m1) [DyLight 680]
NBP2-47979FR 0.1 mL

Mouse Monoclonal CD2 Antibody (HuLy-m1) [DyLight 680]

Sign In for Pricing
View Details
Anti-Prolactin/PRL Antibody Picoband®, APC Conjugate
A00601-1-APC 100 µg/Vial

Anti-Prolactin/PRL Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
GATAD2A, NT (GATAD2A, Transcriptional repressor p66-alpha, GATA zinc finger domain-containing protein 2A) (APC) discontinued
035928-APC 200 µL

GATAD2A, NT (GATAD2A, Transcriptional repressor p66-alpha, GATA zinc finger domain-containing protein 2A) (APC) discontinued

Sign In for Pricing
View Details
Rabbit anti-Devario malabaricus (Malabar danio)(Danio malabaricus) SHH Polyclonal Antibody
MBS7141918 Inquire

Rabbit anti-Devario malabaricus (Malabar danio)(Danio malabaricus) SHH Polyclonal Antibody

Sign In for Pricing
View Details
T-00127_HEV1 1mg
A19240-1 1 mg

T-00127_HEV1 1mg

Sign In for Pricing
View Details
BMPER Antibody
E046349 100 µg -100 µL

BMPER Antibody

Sign In for Pricing
View Details