Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX25 Rabbit pAb (APR20871N)

Product Specifications

Background

May be involved in several stages of intracellular trafficking.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SNX25 Rabbit pAb (APR20871N) .

Synonyms

SNX25; MSTP043; SBBI31

Gene ID

83891

UniProt

Q9H3E2

Cellular Locus

Endosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 64kDa/97kDa Observed MW: 98kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=83891

Uniprot URL

https://www.uniprot.org/uniprot/Q9H3E2

AA Sequence

MKADLLRARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGALDEGEGPQSQKILQFEDILANTFYREHFGMYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Glucose Regulated Protein 78 (Hspa5, Heat Shock Protein 5, 78kD, 78kD Glucose-Regulated Protein precursor, AL022860, AU019543, Bip, BiP, D2Wsu141e, D2Wsu17e, Grp78, GRP 78, Heat shock 70kD protein 5, Heat Shock 70kD Protein 5, Hsce70, Immunoglobulin heavy chain-binding protein, mBiP, Sez7, SEZ-7) (Not for Export EU) discontinued. see 384970
G3057-20U-01 50 µL

Glucose Regulated Protein 78 (Hspa5, Heat Shock Protein 5, 78kD, 78kD Glucose-Regulated Protein precursor, AL022860, AU019543, Bip, BiP, D2Wsu141e, D2Wsu17e, Grp78, GRP 78, Heat shock 70kD protein 5, Heat Shock 70kD Protein 5, Hsce70, Immunoglobulin heavy chain-binding protein, mBiP, Sez7, SEZ-7) (Not for Export EU) discontinued. see 384970

Ask
View Details
Glucose Regulated Protein 78 (Hspa5, Heat Shock Protein 5, 78kD, 78kD Glucose-Regulated Protein precursor, AL022860, AU019543, Bip, BiP, D2Wsu141e, D2Wsu17e, Grp78, GRP 78, Heat shock 70kD protein 5, Heat Shock 70kD Protein 5, Hsce70, Immunoglobulin heavy chain-binding protein, mBiP, Sez7, SEZ-7) (Not for Export EU) discontinued. see 384970
G3057-20U-02 200 µL

Glucose Regulated Protein 78 (Hspa5, Heat Shock Protein 5, 78kD, 78kD Glucose-Regulated Protein precursor, AL022860, AU019543, Bip, BiP, D2Wsu141e, D2Wsu17e, Grp78, GRP 78, Heat shock 70kD protein 5, Heat Shock 70kD Protein 5, Hsce70, Immunoglobulin heavy chain-binding protein, mBiP, Sez7, SEZ-7) (Not for Export EU) discontinued. see 384970

Ask
View Details
IFITM3 (Interferon Induced Transmembrane Protein 3 (1-8U), 1-8U, IP15) (APC)
247408-APC 100 µL

IFITM3 (Interferon Induced Transmembrane Protein 3 (1-8U), 1-8U, IP15) (APC)

Ask
View Details
Enzalutamide carboxylic acid
MF-0093244-01 1 mg

Enzalutamide carboxylic acid

Ask
View Details
Enzalutamide carboxylic acid
MF-0093244-02 2 mg

Enzalutamide carboxylic acid

Ask
View Details
Enzalutamide carboxylic acid
MF-0093244-03 5 mg

Enzalutamide carboxylic acid

Ask
View Details