Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA4 Rabbit pAb (APR20862N)

Product Specifications

Background

This gene encodes a member of the HtrA family of proteases. The encoded protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HTRA4 Rabbit pAb (APR20862N) .

Synonyms

HTRA4

Gene ID

203100

UniProt

P83105

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa Observed MW: 51kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=203100

Uniprot URL

https://www.uniprot.org/uniprot/P83105

AA Sequence

EKLHTQPSCPAVCQPTRCPALPTCALGTTPVFDLCRCCRVCPAAEREVCGGAQGQPCAPGLQCLQPLRPGFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLGKVPAVPVQWGNCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SAP102 Antibody FL550 Conjugate
75-058-FL550 200 µL

Anti-SAP102 Antibody FL550 Conjugate

Sign In for Pricing
View Details
Human BCL6 Knockout HEK293T cell line
GTR15403347 1 Vial

Human BCL6 Knockout HEK293T cell line

Sign In for Pricing
View Details
FGD1 (FYVE, RhoGEF and PH Domain-containing Protein 1, FYVE, RhoGEF and PH Domain Containing 1)
481032 100 µL

FGD1 (FYVE, RhoGEF and PH Domain-containing Protein 1, FYVE, RhoGEF and PH Domain Containing 1)

Sign In for Pricing
View Details
Haptoglobin discontinued
537102-01 30ul

Haptoglobin discontinued

Sign In for Pricing
View Details
Haptoglobin discontinued
537102-02 100 µL

Haptoglobin discontinued

Sign In for Pricing
View Details
TAFI (Thrombin Activatable Fibrinolysis Inhibitor) (APC) discontinued
T0600-95H-APC 100 µL

TAFI (Thrombin Activatable Fibrinolysis Inhibitor) (APC) discontinued

Sign In for Pricing
View Details