Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUMF1 Rabbit pAb (APR20851N)

Product Specifications

Background

This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SUMF1 Rabbit pAb (APR20851N) .

Synonyms

SUMF1; AAPA3037; FGE; UNQ3037

Gene ID

285362

UniProt

Q8NBK3

Cellular Locus

Endoplasmic reticulum lumen

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/37kDa/38kDa/40kDa/46kDa Observed MW: 41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=285362

Uniprot URL

https://www.uniprot.org/uniprot/Q8NBK3

AA Sequence

SQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRYSREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish PSMC1a/b Rabbit Polyclonal Antibody (Cy3)
orb2817591 100 µg

Zebrafish PSMC1a/b Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
5- (2,3-Difluorophenyl) furan-2-carbaldehyde
BVB63506-01 50 mg

5- (2,3-Difluorophenyl) furan-2-carbaldehyde

Sign In for Pricing
View Details
5- (2,3-Difluorophenyl) furan-2-carbaldehyde
BVB63506-02 0.5 g

5- (2,3-Difluorophenyl) furan-2-carbaldehyde

Sign In for Pricing
View Details
IL17RD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1080608 1.0 µg DNA

IL17RD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SLC7A14 Protein Lysate (Mouse) with C-HA Tag
44275034 100 µg

SLC7A14 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
CACNG6 Protein Vector (Mouse) (pPM-C-His)
PV160965 500 ng

CACNG6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details