Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGSF8 Rabbit pAb (APR20844N)

Product Specifications

Background

This gene encodes a member the EWI subfamily of the immunoglobulin protein superfamily. Members of this family contain a single transmembrane domain, an EWI (Glu-Trp-Ile) -motif and a variable number of immunoglobulin domains. This protein interacts with the tetraspanins CD81 and CD9 and may regulate their role in certain cellular functions including cell migration and viral infection. The encoded protein may also function as a tumor suppressor by inhibiting the proliferation of certain cancers. Alternate splicing results in multiple transcript variants that encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IGSF8 Rabbit pAb (APR20844N) .

Synonyms

IGSF8; CD316; CD81P3; EWI-2; EWI2; KCT-4; LIR-D1; PGRL

Gene ID

93185

UniProt

Q969P0

Cellular Locus

Cell membrane, Single-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/55kDa/65kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=93185

Uniprot URL

https://www.uniprot.org/uniprot/Q969P0

AA Sequence

REVLVPEGPLYRVAGTAVSISCNVTGYEGPAQQNFEWFLYRPEAPDTALGIVSTKDTQFSYAVFKSRVVAGEVQVQRLQGDAVVLKIARLQAQDAGIYECHTPSTDTRYLGSYSGKVELRVLPDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQTLSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PPP2R2C (Serine/Threonine-Protein Phosphatase 2A 55kD Regulatory Subunit B gamma isoform, IMYPNO1, PP2A Subunit B isoform B55-gamma, PP2A Subunit B isoform PR55-gamma, PP2A Subunit B isoform R2-gamma, PP2A Subunit B isoform gamma, PPP2R2C) (MaxLight 550)
MBS6458358-01 0.1 mL

PPP2R2C (Serine/Threonine-Protein Phosphatase 2A 55kD Regulatory Subunit B gamma isoform, IMYPNO1, PP2A Subunit B isoform B55-gamma, PP2A Subunit B isoform PR55-gamma, PP2A Subunit B isoform R2-gamma, PP2A Subunit B isoform gamma, PPP2R2C) (MaxLight 550)

Ask
View Details
PPP2R2C (Serine/Threonine-Protein Phosphatase 2A 55kD Regulatory Subunit B gamma isoform, IMYPNO1, PP2A Subunit B isoform B55-gamma, PP2A Subunit B isoform PR55-gamma, PP2A Subunit B isoform R2-gamma, PP2A Subunit B isoform gamma, PPP2R2C) (MaxLight 550)
MBS6458358-02 5x 0.1 mL

PPP2R2C (Serine/Threonine-Protein Phosphatase 2A 55kD Regulatory Subunit B gamma isoform, IMYPNO1, PP2A Subunit B isoform B55-gamma, PP2A Subunit B isoform PR55-gamma, PP2A Subunit B isoform R2-gamma, PP2A Subunit B isoform gamma, PPP2R2C) (MaxLight 550)

Ask
View Details
TSSC1-IT1 AAV Vector (Human) (CMV)
48640101 1 µg

TSSC1-IT1 AAV Vector (Human) (CMV)

Ask
View Details
Human Tubulin Alpha 4A (TUBa4A) ELISA Kit
RDR-TUBa4A-Hu-01 96 Tests

Human Tubulin Alpha 4A (TUBa4A) ELISA Kit

Ask
View Details
Human Tubulin Alpha 4A (TUBa4A) ELISA Kit
RDR-TUBa4A-Hu-02 48 Tests

Human Tubulin Alpha 4A (TUBa4A) ELISA Kit

Ask
View Details
L-Alanyl-L-proline tert-Butyl Ester
MBS6075850-01 25 mg

L-Alanyl-L-proline tert-Butyl Ester

Ask
View Details