Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAND1 Rabbit pAb (APR20834N)

Product Specifications

Background

This gene encodes an essential regulator of Cullin-RING ubiquitin ligases, which are in involved in ubiquitinylation of proteins degraded by the Ub proteasome system. The encoded protein binds to unneddylated cullin-RING box protein complexes and acts as an inhibitor of cullin neddylation and of Skp1, cullin, and F box ubiquitin ligase complex assembly and activity. In mammalian cell culture, this protein predominantly localizes to the cytoplasm. Knockdown of this gene in preadipocytes results in blocked adipogenesis. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CAND1 Rabbit pAb (APR20834N) .

Synonyms

CAND1; TIP120; TIP120A

Gene ID

55832

UniProt

Q86VP6

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa/117kDa/136kDa Observed MW: 136kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55832

Uniprot URL

https://www.uniprot.org/uniprot/Q86VP6

AA Sequence

GALSAMLDFFQALVVTGTNNLGYMDLLRMLTGPVYSQSTALTHKQSYYSIAKCVAALTRACPKEGPAVVGQFIQDVKNSRSTDSIRLLALLSLGEVGHHIDLSGQLELKSVILEAFSSPSEEVKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVENIWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD19 Antibody (Bu12) [Alexa Fluor 488]
NB100-64360AF488 0.1 mL

Mouse Monoclonal CD19 Antibody (Bu12) [Alexa Fluor 488]

Sign In for Pricing
View Details
BRD8 Protein Vector (Rat) (pPM-C-His)
PV256561 500 ng

BRD8 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Chicken Secreted Frizzled Related Protein 4 ELISA Kit
MBS083766 Inquire

Chicken Secreted Frizzled Related Protein 4 ELISA Kit

Sign In for Pricing
View Details
Rabbit Gamma-Amanitin (G-ANT) ELISA Kit
MBS9348132 Inquire

Rabbit Gamma-Amanitin (G-ANT) ELISA Kit

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Thalamus (Frozen)
MBS640264-01 5 Slides

Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Thalamus (Frozen)

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Thalamus (Frozen)
MBS640264-02 5x 5 Slides

Tissue, Section, Human Disease, Multiple Sclerosis, Brain, Thalamus (Frozen)

Sign In for Pricing
View Details