Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA7 Rabbit pAb (APR20832N)

Product Specifications

Background

This gene, originally isolated from testis, is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPATA7 Rabbit pAb (APR20832N) .

Synonyms

SPATA7; HEL-S-296; HSD-3.1; HSD3; LCA3

Gene ID

55812

UniProt

Q9P0W8

Cellular Locus

Cytoplasm, cilium axoneme, cilium basal body, cytoskeleton

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/64kDa/67kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55812

Uniprot URL

https://www.uniprot.org/uniprot/Q9P0W8

AA Sequence

MNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ccdc126 (BC095987) AAV Particle
MR200333A1V 250 µL

Mouse Ccdc126 (BC095987) AAV Particle

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), 0.2mg/mL
BNUB3177-500 1x 500 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), 0.2mg/mL

Sign In for Pricing
View Details
MIR4445 Human qPCR Primer Pair (MI0016788)
HP300963 200 Reactions

MIR4445 Human qPCR Primer Pair (MI0016788)

Sign In for Pricing
View Details
BTF3P14 Protein Vector (Human) (pPM-C-His)
PV065180 500 ng

BTF3P14 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
PSA (KLK3) Antibody
abx011055 100 µL

PSA (KLK3) Antibody

Sign In for Pricing
View Details
Recombinant Human Zinc finger transcription factor Trps1 (C-His)
32-10762-500 500 µg

Recombinant Human Zinc finger transcription factor Trps1 (C-His)

Sign In for Pricing
View Details