Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA7 Rabbit pAb (APR20832N)

Product Specifications

Background

This gene, originally isolated from testis, is also expressed in retina. Mutations in this gene are associated with Leber congenital amaurosis and juvenile retinitis pigmentosa. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SPATA7 Rabbit pAb (APR20832N) .

Synonyms

SPATA7; HEL-S-296; HSD-3.1; HSD3; LCA3

Gene ID

55812

UniProt

Q9P0W8

Cellular Locus

Cytoplasm, cilium axoneme, cilium basal body, cytoskeleton

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa/64kDa/67kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55812

Uniprot URL

https://www.uniprot.org/uniprot/Q9P0W8

AA Sequence

MNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaBP8 siRNA (h)
sc-89449 10 µM

CaBP8 siRNA (h)

Sign In for Pricing
View Details
CDC25A Human shRNA Lentiviral Particle (Locus ID 993)
TL314053V 500 µL Each

CDC25A Human shRNA Lentiviral Particle (Locus ID 993)

Sign In for Pricing
View Details
CDC14B (Dual Specificity Protein Phosphatase CDC14B, Cell Division Cycle 14B)
477567 100 µL

CDC14B (Dual Specificity Protein Phosphatase CDC14B, Cell Division Cycle 14B)

Sign In for Pricing
View Details
RPL23AP79 ORF Vector (Human) (pORF)
ORF030396 1.0 µg DNA

RPL23AP79 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Bovine Alpha- (1,3) -fucosyltransferase (FUT5) ELISA Kit
NSL1634Bo 96 Tests

Bovine Alpha- (1,3) -fucosyltransferase (FUT5) ELISA Kit

Sign In for Pricing
View Details
Dlx2 (NM_001191746) Rat Untagged Clone
RN216383 10 µg

Dlx2 (NM_001191746) Rat Untagged Clone

Sign In for Pricing
View Details