Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS2 Rabbit pAb (APR20826N)

Product Specifications

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S2 family. Alternatively spliced transcript variants have been observed for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MRPS2 Rabbit pAb (APR20826N) .

Synonyms

MRPS2; CGI-91; MRP-S2; S2mt

Gene ID

51116

UniProt

Q9Y399

Cellular Locus

Mitochondrion

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51116

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y399

AA Sequence

MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIRESEDSTDFNDKILNEPLKHSDFFNVKELFSVRSLFDARVHLGHKAGCRHRFMEPYIFGSRLDHDIIDLEQTATHLQLALNFTAHMAYRKGIILFISRNRQFSYLIENMARDCGEYAHTRYFRGGMLTNARLLFGPTVRLPDLIIFLHTLNNIFEPHVAVRDAAKMNIPTVGIVDTNCNPCLITYPVPGNDDSPLAVHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Selectin, Platelet (SELP) ELISA Kit
RDR-SELP-Rb-01 96 Tests

Rabbit Selectin, Platelet (SELP) ELISA Kit

Sign In for Pricing
View Details
Rabbit Selectin, Platelet (SELP) ELISA Kit
RDR-SELP-Rb-02 48 Tests

Rabbit Selectin, Platelet (SELP) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS701815 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
CRCT1 Human Gene Knockout Kit (CRISPR)
KN423129 1 Kit

CRCT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANP (NPPA) (NM_006172) Human Over-expression Lysate
LY401862 100 µg

ANP (NPPA) (NM_006172) Human Over-expression Lysate

Sign In for Pricing
View Details
Mlkl Rabbit Monoclonal Antibody
TA422278 100 µL

Mlkl Rabbit Monoclonal Antibody

Sign In for Pricing
View Details