Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLL1 Rabbit pAb (APR20824N)

Product Specifications

Background

DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DLL1 Rabbit pAb (APR20824N) .

Synonyms

DLL1; DELTA1; DL1; Delta

Gene ID

28514

UniProt

O00548

Cellular Locus

Apical cell membrane, Cell junction, Membrane raft, Single-pass type I membrane protein, adherens junction

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa/78kDa Observed MW: 78kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=28514

Uniprot URL

https://www.uniprot.org/uniprot/O00548

AA Sequence

LQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIATEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Beta Amyloid Antibody
RC-022-01 50 μL

Recombinant Beta Amyloid Antibody

Sign In for Pricing
View Details
Recombinant Beta Amyloid Antibody
RC-022-02 100 µL

Recombinant Beta Amyloid Antibody

Sign In for Pricing
View Details
Recombinant Beta Amyloid Antibody
RC-022-03 1 mL

Recombinant Beta Amyloid Antibody

Sign In for Pricing
View Details
Mouse IL-1 beta/IL1B, C-His, Flag Tag
HA210706-01 20 µg

Mouse IL-1 beta/IL1B, C-His, Flag Tag

Sign In for Pricing
View Details
Mouse IL-1 beta/IL1B, C-His, Flag Tag
HA210706-02 50 µg

Mouse IL-1 beta/IL1B, C-His, Flag Tag

Sign In for Pricing
View Details
Mouse IL-1 beta/IL1B, C-His, Flag Tag
HA210706-03 100 µg

Mouse IL-1 beta/IL1B, C-His, Flag Tag

Sign In for Pricing
View Details