Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PWP1 Rabbit pAb (APR20820N)

Product Specifications

Background

The protein encoded by this gene contains several WD-40 repeats and is found mostly in the nucleus. The expression and localization of this protein are cell cycle dependent. Expression of this gene is upregulated in pancreatic adenocarcinoma. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PWP1 Rabbit pAb (APR20820N) .

Synonyms

PWP1; IEF-SSP-9502; PWP1 homolog

Gene ID

11137

UniProt

Q13610

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa/55kDa Observed MW: 54kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11137

Uniprot URL

https://www.uniprot.org/uniprot/Q13610

AA Sequence

MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSEDGMQSARTQARPREPLEDGDPEDDRTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nk-1.1 Antigen Antibody (Preservative Free)
GWB-4CD151 1 mg

Mouse Nk-1.1 Antigen Antibody (Preservative Free)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g74320 Polyclonal Antibody
MBS7145254 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At1g74320 Polyclonal Antibody

Sign In for Pricing
View Details
TentaGel® R PAL
R28022.25G 25 g

TentaGel® R PAL

Sign In for Pricing
View Details
ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (FITC)
MBS6272864-01 0.2 mL

ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (FITC)

Sign In for Pricing
View Details
ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (FITC)
MBS6272864-02 5x 0.2 mL

ALG10, NT (ALG10, ALG10A, Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase, Alpha-1,2-glucosyltransferase ALG10-A, Alpha-2-glucosyltransferase ALG10-A, Asparagine-linked glycosylation protein 10 homolog A) (FITC)

Sign In for Pricing
View Details
Anti-GRHPR antibody
PAab03645 100 µg

Anti-GRHPR antibody

Sign In for Pricing
View Details